PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g31710.3.p
Common NameBRADI_2g31710, LOC100824282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 652aa    MW: 72655.2 Da    PI: 7.9062
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g31710.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.63.8e-26549600152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek+isle++++yFs+++k+AAk+Lgvc+T++KriCR++GI+ WP+R i+++
  Bradi2g31710.3.p 549 AEKTISLEVIQQYFSGSLKSAAKSLGVCPTTMKRICRKHGIPHWPSREISKV 600
                       589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.017539620IPR003035RWP-RK domain
PfamPF020424.6E-23552600IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MDLDSSDGEA WLLDALATPP LFSAAAPLPW LCGDQHYSSL PMDAVSDLDE TPGTRSGESE  60
TAAKKVENMN GKMQVPVSLD DDYSDCSHFM KERLALALSY FKESTDQHLL VQVWIPTKNG  120
DRYVLTTSGH PFLLAQESIK LVQYRAVSMT YAFSVDGENV HDLGLPGRVY KQRVPEWTPS  180
VQYYSSFEYP RLNHAINHNV HGTVALPVFD PSMKSCIGVV ELIMTSKKVN YASEVDKVCK  240
ALEAVNLKST KIVEHPCVQI CNESRQVALV EILEILTVVC EEFKLPLGQT WVPCKYQSLL  300
AHGGVKRSCL SFGGSCMEEV CISTSDVAFH IIDARMWGFR DACVAHHLQK GQGVSGKAFI  360
SGRPCFSKDV SRFSKMEYPL VHYARMFALA GCFSIYLQSA YTGDDYILEF FLPPDCREDD  420
EQKALLQSII VLLRQHLRTL QVAGDKGLNE ACLQVDAVTV MHNEETGNTY VQDLNVGGGI  480
HTLLESDMHG GIHESDNRNH KASTMSKNHL LSHDYSGDKP VAIPSGSGTS DSSLLYKNKK  540
NPVRRRGKAE KTISLEVIQQ YFSGSLKSAA KSLGVCPTTM KRICRKHGIP HWPSREISKV  600
NKSISKLKEI NQGKRKLLRF TFLLVMNTKL HPRRSHYKIV AQAYSFPHKP F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753898.10.0PREDICTED: protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0Q3R0L40.0A0A0Q3R0L4_BRADI; Uncharacterized protein
STRINGSb03g000490.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein